Lineage for d3qvca_ (3qvc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061087Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256045] (1 PDB entry)
  8. 2061088Domain d3qvca_: 3qvc A: [249000]
    automated match to d1miqb_
    complexed with edo

Details for d3qvca_

PDB Entry: 3qvc (more details), 2.1 Å

PDB Description: Crystal structure of histo-aspartic protease (HAP) zymogen from Plasmodium falciparum
PDB Compounds: (A:) Histo-aspartic protease

SCOPe Domain Sequences for d3qvca_:

Sequence, based on SEQRES records: (download)

>d3qvca_ b.50.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kystvgfniensydrlmktikehklknyikesvklfnkgltkksylgsefdnvelkdlan
vlsfgeaklgdngqkfnflfhtassnvwvpsikctsescesknhydssksktyekddtpv
kltskagtisgifskdlvtigklsvpykfiemteivgfepfysesdvdgvfglgwkdlsi
gsidpyivelktqnkieqavysiylppenknkgyltiggieerffdgplnyeklnhdlmw
qvdldvhfgnvsskkanvildsatsvitvpteffnqfvesasvfkvpflslyvttcgntk
lptleyrspnkvytlepkqyleplenifsalcmlnivpidlekntfvlgdpfmrkyftvy
dydnhtvgfalaknl

Sequence, based on observed residues (ATOM records): (download)

>d3qvca_ b.50.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kystvgfniensydrlmktikehklknyikesvklfnkgltkkdnvelkdlanvlsfgea
klgdngqkfnflfhtassnvwvpsikctsescesknhydssksktyekddtpvkltskag
tisgifskdlvtigklsvpykfiemteivgfepfysesdvdgvfglgwkdlsigsidpyi
velktqnkieqavysiylppenknkgyltiggieerffdgplnyeklnhdlmwqvdldvh
fgnvsskkanvildsatsvitvpteffnqfvesasvfkvpflslyvttcgntklptleyr
spnkvytlepkqyleplenifsalcmlnivpidlekntfvlgdpfmrkyftvydydnhtv
gfalaknl

SCOPe Domain Coordinates for d3qvca_:

Click to download the PDB-style file with coordinates for d3qvca_.
(The format of our PDB-style files is described here.)

Timeline for d3qvca_: