SCOPe 2.08: Domain d3quha_: 3quh A:

Lineage for d3quha_ (3quh A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)

8. Domain d3quha_: 3quh A: [248998]
   automated match to d3rtlb_
   complexed with gol, mnr

Details for d3quha_

PDB Entry: 3quh, 2.7 Å

PDB Description: Structure of heme transport protein IsdH-NEAT3 from S. aureus in complex with Manganese(III)-porphyrin

PDB Compounds: (A:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3quha_:

Sequence; same for both SEQRES and ATOM records:

>d3quha_ b.1.28.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
ltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdlivegkr
vttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdi

Timeline for d3quha_:

• d3quha_ first appeared in SCOPe 2.04
  
• d3quha_ appears in SCOPe 2.07