Lineage for d3qu8c_ (3qu8 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1499255Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1499256Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1499257Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 1499730Protein automated matches [190068] (8 species)
    not a true protein
  7. 1499745Species Human (Homo sapiens) [TaxId:9606] [189507] (18 PDB entries)
  8. 1499763Domain d3qu8c_: 3qu8 C: [248992]
    automated match to d3ibda_
    complexed with 3qu, cm5, hem

Details for d3qu8c_

PDB Entry: 3qu8 (more details), 2.8 Å

PDB Description: Crystal structure of a human cytochrome P450 2B6 (Y226H/K262R) in complex with the inhibitor 4-(4-Nitrobenzyl)pyridine.
PDB Compounds: (C:) Cytochrome P450 2B6

SCOPe Domain Sequences for d3qu8c_:

Sequence, based on SEQRES records: (download)

>d3qu8c_ a.104.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq
eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs
lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt
yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
lffttilqnfsmaspvapedidltpqecgvgkipptyqirflprh

Sequence, based on observed residues (ATOM records): (download)

>d3qu8c_ a.104.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdgkrsveeriqeea
qclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfslis
svfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyll
hmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreieq
vigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevfl
ilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflff
ttilqnfsmaspvapedidltpqecgvgkipptyqirflprh

SCOPe Domain Coordinates for d3qu8c_:

Click to download the PDB-style file with coordinates for d3qu8c_.
(The format of our PDB-style files is described here.)

Timeline for d3qu8c_: