Lineage for d3qu8c1 (3qu8 C:28-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005470Domain d3qu8c1: 3qu8 C:28-491 [248992]
    Other proteins in same PDB: d3qu8a2, d3qu8b2, d3qu8c2, d3qu8e2
    automated match to d3ibda_
    complexed with 3qu, cm5, hem

Details for d3qu8c1

PDB Entry: 3qu8 (more details), 2.8 Å

PDB Description: Crystal structure of a human cytochrome P450 2B6 (Y226H/K262R) in complex with the inhibitor 4-(4-Nitrobenzyl)pyridine.
PDB Compounds: (C:) Cytochrome P450 2B6

SCOPe Domain Sequences for d3qu8c1:

Sequence, based on SEQRES records: (download)

>d3qu8c1 a.104.1.1 (C:28-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq
eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs
lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt
yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
lffttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

Sequence, based on observed residues (ATOM records): (download)

>d3qu8c1 a.104.1.1 (C:28-491) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdgkrsveeriqeea
qclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfslis
svfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidtyll
hmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyreieq
vigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdtevfl
ilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelflff
ttilqnfsmaspvapedidltpqecgvgkipptyqirflpr

SCOPe Domain Coordinates for d3qu8c1:

Click to download the PDB-style file with coordinates for d3qu8c1.
(The format of our PDB-style files is described here.)

Timeline for d3qu8c1: