Lineage for d3qsie_ (3qsi E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2561134Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2561135Protein automated matches [226892] (5 species)
    not a true protein
  7. 2561144Species Helicobacter pylori [TaxId:563041] [226192] (2 PDB entries)
  8. 2561153Domain d3qsie_: 3qsi E: [248984]
    automated match to d2y3ya_
    complexed with ni, so4

Details for d3qsie_

PDB Entry: 3qsi (more details), 3.08 Å

PDB Description: nickel binding domain of nikr from helicobacter pylori disclosing partial metal occupancy
PDB Compounds: (E:) NikR nickel-responsive regulator

SCOPe Domain Sequences for d3qsie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qsie_ d.58.18.0 (E:) automated matches {Helicobacter pylori [TaxId: 563041]}
skiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfeiqr
lqleigglrgvkfakltkas

SCOPe Domain Coordinates for d3qsie_:

Click to download the PDB-style file with coordinates for d3qsie_.
(The format of our PDB-style files is described here.)

Timeline for d3qsie_: