Lineage for d3qpoa_ (3qpo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737540Species Norway rat (Rattus norvegicus) [TaxId:10116] [255521] (12 PDB entries)
  8. 2737544Domain d3qpoa_: 3qpo A: [248973]
    automated match to d4lm1a_
    complexed with mg, pfr, so4, zn

Details for d3qpoa_

PDB Entry: 3qpo (more details), 1.8 Å

PDB Description: Structure of PDE10-inhibitor complex
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3qpoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpoa_ a.211.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlparicrdielfhfdigpfenmwpgifvymihrscgtscfeleklcrfimsvkknyrrv
pyhnwkhavtvahcmyailqnnnglftdlerkglliaclchdldhrgfsnsylqkfdhpl
aalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgnr
kqleemyqtgslnlhnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegde
mkklgiqpipmmdrdkrdevpqgqlgfynavaipcyttltqilpptepllkacrdnlnqw
ekvir

SCOPe Domain Coordinates for d3qpoa_:

Click to download the PDB-style file with coordinates for d3qpoa_.
(The format of our PDB-style files is described here.)

Timeline for d3qpoa_: