| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Larimichthys crocea [TaxId:215358] [256043] (1 PDB entry) |
| Domain d3qpmc_: 3qpm C: [248969] automated match to d2z9sa_ complexed with gol |
PDB Entry: 3qpm (more details), 1.9 Å
SCOPe Domain Sequences for d3qpmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qpmc_ c.47.1.10 (C:) automated matches {Larimichthys crocea [TaxId: 215358]}
hlskakiskpapqwegtavingefkelklsdyrgkylvfffypldftfvcpteiiafsdr
vhefraintevvacsvdsqfthlawiitprkqgglgpmkipllsdlthqiskdygvyled
qghtlrglfiidekgvlrqitmndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsd
tiipdpsgklkyfd
Timeline for d3qpmc_:
View in 3DDomains from other chains: (mouse over for more information) d3qpma_, d3qpmb_, d3qpmd_, d3qpme_ |