Lineage for d3qpmc_ (3qpm C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878278Species Larimichthys crocea [TaxId:215358] [256043] (1 PDB entry)
  8. 2878281Domain d3qpmc_: 3qpm C: [248969]
    automated match to d2z9sa_
    complexed with gol

Details for d3qpmc_

PDB Entry: 3qpm (more details), 1.9 Å

PDB Description: Crystal structure of peroxiredoxin Prx4 from Pseudosciaena crocea
PDB Compounds: (C:) peroxiredoxin

SCOPe Domain Sequences for d3qpmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpmc_ c.47.1.10 (C:) automated matches {Larimichthys crocea [TaxId: 215358]}
hlskakiskpapqwegtavingefkelklsdyrgkylvfffypldftfvcpteiiafsdr
vhefraintevvacsvdsqfthlawiitprkqgglgpmkipllsdlthqiskdygvyled
qghtlrglfiidekgvlrqitmndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsd
tiipdpsgklkyfd

SCOPe Domain Coordinates for d3qpmc_:

Click to download the PDB-style file with coordinates for d3qpmc_.
(The format of our PDB-style files is described here.)

Timeline for d3qpmc_: