SCOPe 2.08: Domain d3qpmb_: 3qpm B:

Lineage for d3qpmb_ (3qpm B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Larimichthys crocea [TaxId:215358] [256043] (1 PDB entry)

8. Domain d3qpmb_: 3qpm B: [248968]
   automated match to d2z9sa_
   complexed with gol

Details for d3qpmb_

PDB Entry: 3qpm, 1.9 Å

PDB Description: Crystal structure of peroxiredoxin Prx4 from Pseudosciaena crocea

PDB Compounds: (B:) peroxiredoxin

SCOPe Domain Sequences for d3qpmb_:

Sequence; same for both SEQRES and ATOM records:

>d3qpmb_ c.47.1.10 (B:) automated matches {Larimichthys crocea [TaxId: 215358]}
hlskakiskpapqwegtavingefkelklsdyrgkylvfffypldftfvcpteiiafsdr
vhefraintevvacsvdsqfthlawiitprkqgglgpmkipllsdlthqiskdygvyled
qghtlrglfiidekgvlrqitmndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgsd
tiipdpsgklkyfd

Timeline for d3qpmb_:

• d3qpmb_ first appeared in SCOPe 2.04
  
• d3qpmb_ appears in SCOPe 2.07