SCOPe 2.06: Domain d3qpma_: 3qpm A:

Lineage for d3qpma_ (3qpm A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (19 species)
   not a true protein

7. Species Larimichthys crocea [TaxId:215358] [256043] (1 PDB entry)

8. Domain d3qpma_: 3qpm A: [248967]
   automated match to d2z9sa_
   complexed with gol

Details for d3qpma_

PDB Entry: 3qpm, 1.9 Å

PDB Description: Crystal structure of peroxiredoxin Prx4 from Pseudosciaena crocea

PDB Compounds: (A:) peroxiredoxin

SCOPe Domain Sequences for d3qpma_:

Sequence; same for both SEQRES and ATOM records:

>d3qpma_ c.47.1.10 (A:) automated matches {Larimichthys crocea [TaxId: 215358]}
lhlskakiskpapqwegtavingefkelklsdyrgkylvfffypldftfvcpteiiafsd
rvhefraintevvacsvdsqfthlawiitprkqgglgpmkipllsdlthqiskdygvyle
dqghtlrglfiidekgvlrqitmndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgs
dtiipdpsgklkyfd

Timeline for d3qpma_:

• d3qpma_ first appeared in SCOPe 2.04
  
• d3qpma_ appears in SCOPe 2.05
  
• d3qpma_ appears in SCOPe 2.07
  
• d3qpma_ appears in the current release, SCOPe 2.08