Lineage for d3qpbg_ (3qpb G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889215Species Streptococcus pyogenes [TaxId:301450] [256042] (1 PDB entry)
  8. 2889222Domain d3qpbg_: 3qpb G: [248955]
    automated match to d2b94a_
    complexed with r1p, ura

Details for d3qpbg_

PDB Entry: 3qpb (more details), 1.82 Å

PDB Description: crystal structure of streptococcus pyogenes uridine phosphorylase reveals a subclass of the np-i superfamily
PDB Compounds: (G:) Uridine phosphorylase

SCOPe Domain Sequences for d3qpbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpbg_ c.56.2.0 (G:) automated matches {Streptococcus pyogenes [TaxId: 301450]}
glqyhlqirpgdvgryvimpgdpkrcakiaehfdnavlvadsreyvtytgtlngekvsvt
stgiggpsasiameelklcgadtfirvgtcggieldvkggdiviatgairmegtskeyap
iefpavadlevtnalvnaakklgytshagvvqckdafygqhepermpvsyellnkweawk
rlgtkasemesaalfvaashlgvrcgsdflvvgnqernalgmdnpmahdteaaiqvavea
lrtliendk

SCOPe Domain Coordinates for d3qpbg_:

Click to download the PDB-style file with coordinates for d3qpbg_.
(The format of our PDB-style files is described here.)

Timeline for d3qpbg_: