Lineage for d3qpbc_ (3qpb C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2142063Species Streptococcus pyogenes [TaxId:301450] [256042] (1 PDB entry)
  8. 2142066Domain d3qpbc_: 3qpb C: [248951]
    automated match to d2b94a_
    complexed with r1p, ura

Details for d3qpbc_

PDB Entry: 3qpb (more details), 1.82 Å

PDB Description: crystal structure of streptococcus pyogenes uridine phosphorylase reveals a subclass of the np-i superfamily
PDB Compounds: (C:) Uridine phosphorylase

SCOPe Domain Sequences for d3qpbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpbc_ c.56.2.0 (C:) automated matches {Streptococcus pyogenes [TaxId: 301450]}
ysgevglqyhlqirpgdvgryvimpgdpkrcakiaehfdnavlvadsreyvtytgtlnge
kvsvtstgiggpsasiameelklcgadtfirvgtcggieldvkggdiviatgairmegts
keyapiefpavadlevtnalvnaakklgytshagvvqckdafygqhepermpvsyellnk
weawkrlgtkasemesaalfvaashlgvrcgsdflvvgnqernalgmdnpmahdteaaiq
vavealrtliendk

SCOPe Domain Coordinates for d3qpbc_:

Click to download the PDB-style file with coordinates for d3qpbc_.
(The format of our PDB-style files is described here.)

Timeline for d3qpbc_: