![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 proteins) |
![]() | Protein automated matches [191247] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189737] (31 PDB entries) |
![]() | Domain d3qowa_: 3qow A: [248947] automated match to d1nw3a_ complexed with sam, so4 |
PDB Entry: 3qow (more details), 2.1 Å
SCOPe Domain Sequences for d3qowa_:
Sequence, based on SEQRES records: (download)
>d3qowa_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidy dtksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpe klnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhy gvekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnf afgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsv swtgkpvsyylhtidrtilenyfsslk
>d3qowa_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenylidyd tksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpek lnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhyg vekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfa fgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkwtgk pvsyylhtidrtilenyfsslk
Timeline for d3qowa_: