Lineage for d3qowa_ (3qow A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130146Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 protein domains)
  6. 2130154Protein automated matches [191247] (1 species)
    not a true protein
  7. 2130155Species Human (Homo sapiens) [TaxId:9606] [189737] (27 PDB entries)
  8. 2130156Domain d3qowa_: 3qow A: [248947]
    automated match to d1nw3a_
    complexed with sam, so4

Details for d3qowa_

PDB Entry: 3qow (more details), 2.1 Å

PDB Description: DOT1L Structure in complex with SAM
PDB Compounds: (A:) Histone-lysine N-methyltransferase

SCOPe Domain Sequences for d3qowa_:

Sequence, based on SEQRES records: (download)

>d3qowa_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidy
dtksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpe
klnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhy
gvekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnf
afgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsv
swtgkpvsyylhtidrtilenyfsslk

Sequence, based on observed residues (ATOM records): (download)

>d3qowa_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenylidyd
tksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpek
lnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhyg
vekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfa
fgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkwtgk
pvsyylhtidrtilenyfsslk

SCOPe Domain Coordinates for d3qowa_:

Click to download the PDB-style file with coordinates for d3qowa_.
(The format of our PDB-style files is described here.)

Timeline for d3qowa_: