Lineage for d3qnsa_ (3qns A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557276Species Rhodococcus jostii [TaxId:101510] [256041] (8 PDB entries)
  8. 2557277Domain d3qnsa_: 3qns A: [248945]
    automated match to d2gvka1
    complexed with gol, hem, so4

Details for d3qnsa_

PDB Entry: 3qns (more details), 1.4 Å

PDB Description: dypb from rhodococcus jostii rha1, crystal form 2
PDB Compounds: (A:) DyP Peroxidase

SCOPe Domain Sequences for d3qnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qnsa_ d.58.4.0 (A:) automated matches {Rhodococcus jostii [TaxId: 101510]}
varlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscv
vgvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqiv
salgsaatvvdevhgfryfdsrdllgfvdgtenptdddaadsaligdedpdfrggsyviv
qkylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilr
dnmafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffv
psrdvleslgd

SCOPe Domain Coordinates for d3qnsa_:

Click to download the PDB-style file with coordinates for d3qnsa_.
(The format of our PDB-style files is described here.)

Timeline for d3qnsa_: