Lineage for d3qnfc3 (3qnf C:530-614)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525171Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 1525190Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 1525191Protein automated matches [254707] (3 species)
    not a true protein
  7. 1525192Species Human (Homo sapiens) [TaxId:9606] [255965] (6 PDB entries)
  8. 1525199Domain d3qnfc3: 3qnf C:530-614 [248940]
    Other proteins in same PDB: d3qnfa1, d3qnfa2, d3qnfb1, d3qnfb2, d3qnfb4, d3qnfc1, d3qnfc2, d3qnfc4
    automated match to d2yd0a3
    complexed with nag, zn

Details for d3qnfc3

PDB Entry: 3qnf (more details), 3 Å

PDB Description: crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (C:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3qnfc3:

Sequence, based on SEQRES records: (download)

>d3qnfc3 b.1.30.0 (C:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed

Sequence, based on observed residues (ATOM records): (download)

>d3qnfc3 b.1.30.0 (C:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymktgylwhvpltfitsksdmvhrfllktktdvlilpeeve
wikfnvgmngyyivhyed

SCOPe Domain Coordinates for d3qnfc3:

Click to download the PDB-style file with coordinates for d3qnfc3.
(The format of our PDB-style files is described here.)

Timeline for d3qnfc3: