Lineage for d3qnfc1 (3qnf C:47-254)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820660Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2820697Domain d3qnfc1: 3qnf C:47-254 [248938]
    Other proteins in same PDB: d3qnfa2, d3qnfa3, d3qnfb2, d3qnfb3, d3qnfb4, d3qnfc2, d3qnfc3, d3qnfc4
    automated match to d2yd0a1
    complexed with nag, zn

Details for d3qnfc1

PDB Entry: 3qnf (more details), 3 Å

PDB Description: crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (C:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3qnfc1:

Sequence, based on SEQRES records: (download)

>d3qnfc1 b.98.1.0 (C:47-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisrat
lrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykst
yrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvt
vaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records): (download)

>d3qnfc1 b.98.1.0 (C:47-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisrat
lrkgalseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
gliedhfdvtvkmstylvafiisdf

SCOPe Domain Coordinates for d3qnfc1:

Click to download the PDB-style file with coordinates for d3qnfc1.
(The format of our PDB-style files is described here.)

Timeline for d3qnfc1: