Lineage for d3qnfb4 (3qnf B:615-935)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006934Species Human (Homo sapiens) [TaxId:9606] [189070] (40 PDB entries)
  8. 2006960Domain d3qnfb4: 3qnf B:615-935 [248937]
    Other proteins in same PDB: d3qnfa1, d3qnfa2, d3qnfa3, d3qnfb1, d3qnfb2, d3qnfb3, d3qnfc1, d3qnfc2, d3qnfc3
    automated match to d2yd0a4
    complexed with nag, zn

Details for d3qnfb4

PDB Entry: 3qnf (more details), 3 Å

PDB Description: Crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 ERAP1
PDB Compounds: (B:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3qnfb4:

Sequence, based on SEQRES records: (download)

>d3qnfb4 a.118.1.0 (B:615-935) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflr
knwnklvqkfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtiet
ieenigwmdknfdkirvwlqs

Sequence, based on observed residues (ATOM records): (download)

>d3qnfb4 a.118.1.0 (B:615-935) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgwdsltgllkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvf
qglnelipmyklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllll
acvhnyqpcvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfsls
steksqiefalcrtqnkeklqwlldetqefpqiltligrnpvgyplawqflrkahmvmgt
tnqfstrtrleevqqtietieenigwmdknfdkirvwlqs

SCOPe Domain Coordinates for d3qnfb4:

Click to download the PDB-style file with coordinates for d3qnfb4.
(The format of our PDB-style files is described here.)

Timeline for d3qnfb4: