| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
| Domain d3qnfb3: 3qnf B:530-614 [248936] Other proteins in same PDB: d3qnfa1, d3qnfa2, d3qnfb1, d3qnfb2, d3qnfb4, d3qnfc1, d3qnfc2, d3qnfc4 automated match to d2yd0a3 complexed with nag, zn |
PDB Entry: 3qnf (more details), 3 Å
SCOPe Domain Sequences for d3qnfb3:
Sequence, based on SEQRES records: (download)
>d3qnfb3 b.1.30.0 (B:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl
ilpeevewikfnvgmngyyivhyed
>d3qnfb3 b.1.30.0 (B:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplititvrgrnvhmkqehymtgylwhvpltfitsksdmvhrfllktktdvlilpeevew
ikfnvgmngyyivhyed
Timeline for d3qnfb3: