Lineage for d3qnfb1 (3qnf B:46-254)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2429865Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2429866Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2429953Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2429954Protein automated matches [254706] (5 species)
    not a true protein
  7. 2429958Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)
  8. 2429977Domain d3qnfb1: 3qnf B:46-254 [248934]
    Other proteins in same PDB: d3qnfa2, d3qnfa3, d3qnfb2, d3qnfb3, d3qnfb4, d3qnfc2, d3qnfc3, d3qnfc4
    automated match to d2yd0a1
    complexed with nag, zn

Details for d3qnfb1

PDB Entry: 3qnf (more details), 3 Å

PDB Description: crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (B:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3qnfb1:

Sequence, based on SEQRES records: (download)

>d3qnfb1 b.98.1.0 (B:46-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
tvaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records): (download)

>d3qnfb1 b.98.1.0 (B:46-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
tlrklseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrtk
egelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvaeg
liedhfdvtvkmstylvafiisdf

SCOPe Domain Coordinates for d3qnfb1:

Click to download the PDB-style file with coordinates for d3qnfb1.
(The format of our PDB-style files is described here.)

Timeline for d3qnfb1: