Lineage for d3qnfa2 (3qnf A:255-529)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2964907Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)
  8. 2965021Domain d3qnfa2: 3qnf A:255-529 [248932]
    Other proteins in same PDB: d3qnfa1, d3qnfa3, d3qnfb1, d3qnfb3, d3qnfb4, d3qnfc1, d3qnfc3, d3qnfc4
    automated match to d2yd0a2
    complexed with nag, zn

Details for d3qnfa2

PDB Entry: 3qnf (more details), 3 Å

PDB Description: crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 erap1
PDB Compounds: (A:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3qnfa2:

Sequence, based on SEQRES records: (download)

>d3qnfa2 d.92.1.0 (A:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenpaqiremfd
dvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicptdgvkgm
dgfcsrsqhssssshwhqegvdvktmmntwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d3qnfa2 d.92.1.0 (A:255-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvskitksgvkvsvyavpdkinqadyaldaavtllefyedyfsipyplpkqdlaaipdf
qsgamenwglttyresallfdaekssassklgitmtvahelahqwfgnlvtmewwndlwl
negfakfmefvsvsvthpelkvgdyffgkcfdamevdalnsshpvstpvenddvsydkga
cilnmlreylsadafksgivqylqkhsykntknedlwdsmasivdvktmmntwtlqkg

SCOPe Domain Coordinates for d3qnfa2:

Click to download the PDB-style file with coordinates for d3qnfa2.
(The format of our PDB-style files is described here.)

Timeline for d3qnfa2: