Lineage for d3qlla_ (3qll A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824470Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1824796Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 1824797Protein automated matches [190614] (10 species)
    not a true protein
  7. 1824862Species Yersinia pestis [TaxId:632] [256040] (1 PDB entry)
  8. 1824863Domain d3qlla_: 3qll A: [248928]
    automated match to d1sgja_

Details for d3qlla_

PDB Entry: 3qll (more details), 2.45 Å

PDB Description: crystal structure of ripc from yersinia pestis
PDB Compounds: (A:) Citrate Lyase

SCOPe Domain Sequences for d3qlla_:

Sequence, based on SEQRES records: (download)

>d3qlla_ c.1.12.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
dtyqtrswlftpatrsdrfakaaengadvaiidledsvsqadkeqarqkaisylssrpat
slplalringldtragiedihallecgslpdylvlpktesaahlqildrlmmfagsdtrl
igiiesvrglnavesiaaatpklaglifgaadmaadigaastweplalararlvsacamn
gipaidapffdvhdvsglqsetlrasdfgfsakaaihpaqistintlftptaaeir

Sequence, based on observed residues (ATOM records): (download)

>d3qlla_ c.1.12.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
dtyqtrswlftpatrgadvaiidledsvsqadkeqarqkaislplalringldtragied
ihallecgslpdylvlpktesaahlqildrlmmfadtrligiiesvrglnavesiaaatp
klaglifgaadmaadigaastweplalararlvsacamngipaidapffdvhdvsglqse
tlrasdfgfsakaaihpaqistintlftptaaeir

SCOPe Domain Coordinates for d3qlla_:

Click to download the PDB-style file with coordinates for d3qlla_.
(The format of our PDB-style files is described here.)

Timeline for d3qlla_: