SCOPe 2.04: Domain d3qk9b_: 3qk9 B:

Lineage for d3qk9b_ (3qk9 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.13: TIM44-like [143001] (2 proteins)
   contains extra N-terminal helices but lacks the beta-hairpin in the superfamily-specific insertion
   automatically mapped to Pfam PF04280

6. Protein automated matches [254718] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256039] (1 PDB entry)

8. Domain d3qk9b_: 3qk9 B: [248925]
   automated match to d2fxta1
   complexed with cl

Details for d3qk9b_

PDB Entry: 3qk9, 3.1 Å

PDB Description: Yeast Tim44 C-terminal domain complexed with Cymal-3

PDB Compounds: (B:) Mitochondrial import inner membrane translocase subunit TIM44

SCOPe Domain Sequences for d3qk9b_:

Sequence, based on SEQRES records:

>d3qk9b_ d.17.4.13 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iqslknklwdesenplivvmrkitnkvggffaetessrvysqfklmdptfsnesftrhlr
eyivpeileayvkgdvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivsa
kllapqdipvlvvgcraqeinlyrkkktgeiaagdeanilmssyamvftrdpeqidddet
egwkilefvrggsrqft

Sequence, based on observed residues (ATOM records):

>d3qk9b_ d.17.4.13 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iqslknklwdesenplivvmrkitnessrvysqfkfsnesftrhlreyivpeileayvkg
dvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivsakllapqdipvlvvg
craqeinlyrkkktgeiaagdeanilmssyamvftrdpegwkilefvrggsrqft

Timeline for d3qk9b_:

• d3qk9b_ is new in SCOPe 2.04-stable
  
• d3qk9b_ appears in SCOPe 2.05
  
• d3qk9b_ appears in the current release, SCOPe 2.08