Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.13: TIM44-like [143001] (2 proteins) contains extra N-terminal helices but lacks the beta-hairpin in the superfamily-specific insertion automatically mapped to Pfam PF04280 |
Protein automated matches [254718] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [256039] (1 PDB entry) |
Domain d3qk9a_: 3qk9 A: [248924] automated match to d2fxta1 complexed with cl |
PDB Entry: 3qk9 (more details), 3.1 Å
SCOPe Domain Sequences for d3qk9a_:
Sequence, based on SEQRES records: (download)
>d3qk9a_ d.17.4.13 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qslknklwdesenplivvmrkitnkvggffaetessrvysqfklmdptfsnesftrhlre yivpeileayvkgdvkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivsak llapqdipvlvvgcraqeinlyrkkktgeiaagdeanilmssyamvftrdpeqidddete gwkilefvrggsrqft
>d3qk9a_ d.17.4.13 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qslknklwdesenplivvmrkitnessrvysqfkfsnesftrhlreyivpeileayvkgd vkvlkkwfseapfnvyaaqqkifkeqdvyadgrildirgveivsakllapqdipvlvvgc raqeinlyrkkktgeiaagdeanilmssyamvftrdpegwkilefvrggsrqft
Timeline for d3qk9a_: