| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
| Protein automated matches [191109] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries) |
| Domain d3qk3b_: 3qk3 B: [248920] automated match to d4gr7a_ complexed with edo, so4 |
PDB Entry: 3qk3 (more details), 1.95 Å
SCOPe Domain Sequences for d3qk3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qk3b_ b.11.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafrgeqfvle
kgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivdddvpslwah
gfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvrrir
Timeline for d3qk3b_: