Lineage for d3qk3b_ (3qk3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773666Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)
  8. 2773677Domain d3qk3b_: 3qk3 B: [248920]
    automated match to d4gr7a_
    complexed with edo, so4

Details for d3qk3b_

PDB Entry: 3qk3 (more details), 1.95 Å

PDB Description: Crystal structure of human beta-crystallin B3
PDB Compounds: (B:) Beta-crystallin B3

SCOPe Domain Sequences for d3qk3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qk3b_ b.11.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sykvilyelenfqgkrcelsaecpsltdsllekvgsiqvesgpwlafesrafrgeqfvle
kgdyprwdawsnsrdsdsllslrplnidsphhklhlfenpafsgrkmeivdddvpslwah
gfqdrvasvraingtwvgyefpgyrgrqyvfergeyrhwnewdasqpqlqsvrrir

SCOPe Domain Coordinates for d3qk3b_:

Click to download the PDB-style file with coordinates for d3qk3b_.
(The format of our PDB-style files is described here.)

Timeline for d3qk3b_: