Lineage for d1fd7f_ (1fd7 F:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 798869Protein Heat-labile toxin [50205] (2 species)
  7. 798870Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries)
  8. 798898Domain d1fd7f_: 1fd7 F: [24892]

Details for d1fd7f_

PDB Entry: 1fd7 (more details), 1.8 Å

PDB Description: heat-labile enterotoxin b-pentamer with bound ligand bmsc001
PDB Compounds: (F:) heat-labile enterotoxin b chain

SCOP Domain Sequences for d1fd7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd7f_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1fd7f_:

Click to download the PDB-style file with coordinates for d1fd7f_.
(The format of our PDB-style files is described here.)

Timeline for d1fd7f_: