Lineage for d3qk0a3 (3qk0 A:545-725)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500710Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1500711Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1500712Species Human (Homo sapiens) [TaxId:9606] [48402] (57 PDB entries)
  8. 1500748Domain d3qk0a3: 3qk0 A:545-725 [248917]
    Other proteins in same PDB: d3qk0a1, d3qk0a2, d3qk0a4
    automated match to d1e7ua1
    complexed with qk0, so4

Details for d3qk0a3

PDB Entry: 3qk0 (more details), 2.85 Å

PDB Description: Crystal structure of PI3K-gamma in complex with benzothiazole 82
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3qk0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qk0a3 a.118.1.6 (A:545-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
aempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiv
aktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlv
qavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgc
g

SCOPe Domain Coordinates for d3qk0a3:

Click to download the PDB-style file with coordinates for d3qk0a3.
(The format of our PDB-style files is described here.)

Timeline for d3qk0a3: