Lineage for d3qija3 (3qij A:397-488)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413229Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2413230Protein automated matches [190052] (8 species)
    not a true protein
  7. 2413308Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2413376Domain d3qija3: 3qij A:397-488 [248904]
    Other proteins in same PDB: d3qija1, d3qija2, d3qija4, d3qijb1, d3qijb2, d3qijb4
    automated match to d1gg3a2
    complexed with unx

Details for d3qija3

PDB Entry: 3qij (more details), 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r
PDB Compounds: (A:) Protein 4.1

SCOPe Domain Sequences for d3qija3:

Sequence, based on SEQRES records: (download)

>d3qija3 b.55.1.0 (A:397-488) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpgeq
eqyestigfklpsyraakklwkvcvehhtffr

Sequence, based on observed residues (ATOM records): (download)

>d3qija3 b.55.1.0 (A:397-488) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikiresti
gfklpsyraakklwkvcvehhtffr

SCOPe Domain Coordinates for d3qija3:

Click to download the PDB-style file with coordinates for d3qija3.
(The format of our PDB-style files is described here.)

Timeline for d3qija3: