Lineage for d3qija1 (3qij A:209-290)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638535Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)
  8. 1638540Domain d3qija1: 3qij A:209-290 [248902]
    Other proteins in same PDB: d3qija2, d3qija3, d3qijb2, d3qijb3
    automated match to d1gg3a3
    complexed with unx

Details for d3qija1

PDB Entry: 3qij (more details), 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r
PDB Compounds: (A:) Protein 4.1

SCOPe Domain Sequences for d3qija1:

Sequence, based on SEQRES records: (download)

>d3qija1 d.15.1.0 (A:209-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsa
keikkqvrgvpwnftfnvkfyp

Sequence, based on observed residues (ATOM records): (download)

>d3qija1 d.15.1.0 (A:209-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsa
keikkqvpwnftfnvkfyp

SCOPe Domain Coordinates for d3qija1:

Click to download the PDB-style file with coordinates for d3qija1.
(The format of our PDB-style files is described here.)

Timeline for d3qija1: