| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
| Protein automated matches [226871] (19 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226188] (8 PDB entries) |
| Domain d3qfrb3: 3qfr B:522-680 [248880] Other proteins in same PDB: d3qfra1, d3qfra2, d3qfrb1, d3qfrb2 automated match to d1j9za3 complexed with ca, fad, fmn, nap; mutant |
PDB Entry: 3qfr (more details), 2.4 Å
SCOPe Domain Sequences for d3qfrb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfrb3 c.25.1.0 (B:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws
Timeline for d3qfrb3: