Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins) there is an alpha-helical subdomain inserted in this domain automatically mapped to Pfam PF00667 |
Protein automated matches [227066] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226187] (5 PDB entries) |
Domain d3qfrb2: 3qfr B:243-521 [248879] Other proteins in same PDB: d3qfra1, d3qfra3, d3qfrb1, d3qfrb3 automated match to d1j9za1 complexed with ca, fad, fmn, nap; mutant |
PDB Entry: 3qfr (more details), 2.4 Å
SCOPe Domain Sequences for d3qfrb2:
Sequence, based on SEQRES records: (download)
>d3qfrb2 b.43.4.1 (B:243-521) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw vvearrhilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveye tkagrinkgvatnwlrakepagenggralvpmfvrksqf
>d3qfrb2 b.43.4.1 (B:243-521) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw vvearrhilailqdcpslrppidhlcellprlqahyysiassskvhpnsvhicavvveye tkagrinkgvatnwlrakepralvpmfvrksqf
Timeline for d3qfrb2: