SCOPe 2.07: Domain d3qfrb1: 3qfr B:70-240

Lineage for d3qfrb1 (3qfr B:70-240)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226640] (7 PDB entries)

8. Domain d3qfrb1: 3qfr B:70-240 [248878]
   Other proteins in same PDB: d3qfra2, d3qfra3, d3qfrb2, d3qfrb3
   automated match to d1ja1a2
   complexed with ca, fad, fmn, nap; mutant

Details for d3qfrb1

PDB Entry: 3qfr, 2.4 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase (R457H Mutant)

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qfrb1:

Sequence; same for both SEQRES and ATOM records:

>d3qfrb1 c.23.5.0 (B:70-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgveatg

Timeline for d3qfrb1:

• d3qfrb1 first appeared in SCOPe 2.04
  
• d3qfrb1 appears in SCOPe 2.06
  
• d3qfrb1 appears in the current release, SCOPe 2.08