Lineage for d3qfra3 (3qfr A:522-680)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2859918Species Human (Homo sapiens) [TaxId:9606] [226188] (8 PDB entries)
  8. 2859925Domain d3qfra3: 3qfr A:522-680 [248877]
    Other proteins in same PDB: d3qfra1, d3qfra2, d3qfrb1, d3qfrb2
    automated match to d1j9za3
    complexed with ca, fad, fmn, nap; mutant

Details for d3qfra3

PDB Entry: 3qfr (more details), 2.4 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase (R457H Mutant)
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qfra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfra3 c.25.1.0 (A:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

SCOPe Domain Coordinates for d3qfra3:

Click to download the PDB-style file with coordinates for d3qfra3.
(The format of our PDB-style files is described here.)

Timeline for d3qfra3: