Lineage for d3qfcb2 (3qfc B:245-521)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054656Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 protein domains)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2054677Protein automated matches [227066] (3 species)
    not a true protein
  7. 2054680Species Human (Homo sapiens) [TaxId:9606] [226187] (7 PDB entries)
  8. 2054686Domain d3qfcb2: 3qfc B:245-521 [248873]
    Other proteins in same PDB: d3qfca1, d3qfca3, d3qfcb1, d3qfcb3
    automated match to d1j9za1
    complexed with ca, fad, fmn, nap; mutant

Details for d3qfcb2

PDB Entry: 3qfc (more details), 1.8 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 (V492E mutant)
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qfcb2:

Sequence, based on SEQRES records: (download)

>d3qfcb2 b.43.4.1 (B:245-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlm
hleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpf
pcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvv
earrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveyetk
agrinkgeatnwlrakepvgenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d3qfcb2 b.43.4.1 (B:245-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlm
hleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpf
pcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvv
earrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveykge
atnwlrakepvralvpmfvrksqf

SCOPe Domain Coordinates for d3qfcb2:

Click to download the PDB-style file with coordinates for d3qfcb2.
(The format of our PDB-style files is described here.)

Timeline for d3qfcb2: