Lineage for d3qena_ (3qen A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865780Protein Deoxycytidine kinase [89657] (1 species)
  7. 2865781Species Human (Homo sapiens) [TaxId:9606] [89658] (45 PDB entries)
  8. 2865812Domain d3qena_: 3qen A: [248865]
    automated match to d1p60a_
    complexed with 5bt, udp

    has additional insertions and/or extensions that are not grouped together

Details for d3qena_

PDB Entry: 3qen (more details), 2 Å

PDB Description: S74E dCK in complex with 5-bromodeoxycytidine and UDP
PDB Compounds: (A:) Deoxycytidine kinase

SCOPe Domain Sequences for d3qena_:

Sequence, based on SEQRES records: (download)

>d3qena_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
trikkisiegniaagkstfvnilkqlsedwevvpepvarwsnvqstqdefeeltmeqkng
gnvlqmmyekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifa
snlyesesmnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeq
gipleyleklhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkefls
tl

Sequence, based on observed residues (ATOM records): (download)

>d3qena_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
trikkisiegniaagkstfvnilkqlsedwevvpepvarwsnvqseltmeqknggnvlqm
myekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyes
esmnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipley
leklhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

SCOPe Domain Coordinates for d3qena_:

Click to download the PDB-style file with coordinates for d3qena_.
(The format of our PDB-style files is described here.)

Timeline for d3qena_: