Lineage for d3qe2a2 (3qe2 A:243-521)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054656Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 protein domains)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2054677Protein automated matches [227066] (3 species)
    not a true protein
  7. 2054680Species Human (Homo sapiens) [TaxId:9606] [226187] (7 PDB entries)
  8. 2054683Domain d3qe2a2: 3qe2 A:243-521 [248858]
    Other proteins in same PDB: d3qe2a1, d3qe2a3, d3qe2b1, d3qe2b3
    automated match to d1j9za1
    complexed with ca, fad, fmn, nap

Details for d3qe2a2

PDB Entry: 3qe2 (more details), 1.75 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qe2a2:

Sequence, based on SEQRES records: (download)

>d3qe2a2 b.43.4.1 (A:243-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
vvearrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveye
tkagrinkgvatnwlrakepvgenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d3qe2a2 b.43.4.1 (A:243-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
vvearrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveye
tkagrinkgvatnwlrakepvralvpmfvrksqf

SCOPe Domain Coordinates for d3qe2a2:

Click to download the PDB-style file with coordinates for d3qe2a2.
(The format of our PDB-style files is described here.)

Timeline for d3qe2a2: