SCOPe 2.08: Domain d3qe2a1: 3qe2 A:69-239

Lineage for d3qe2a1 (3qe2 A:69-239)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226640] (7 PDB entries)

8. Domain d3qe2a1: 3qe2 A:69-239 [248857]
   Other proteins in same PDB: d3qe2a2, d3qe2a3, d3qe2b2, d3qe2b3
   automated match to d1ja1a2
   complexed with ca, fad, fmn, nap

Details for d3qe2a1

PDB Entry: 3qe2, 1.75 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase

PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qe2a1:

Sequence; same for both SEQRES and ATOM records:

>d3qe2a1 c.23.5.0 (A:69-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
essfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlssl
peidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamg
kyvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveat

Timeline for d3qe2a1:

• d3qe2a1 first appeared in SCOPe 2.04
  
• d3qe2a1 appears in SCOPe 2.07