Lineage for d3qe2a1 (3qe2 A:69-239)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2856979Species Human (Homo sapiens) [TaxId:9606] [226640] (7 PDB entries)
  8. 2856980Domain d3qe2a1: 3qe2 A:69-239 [248857]
    Other proteins in same PDB: d3qe2a2, d3qe2a3, d3qe2b2, d3qe2b3
    automated match to d1ja1a2
    complexed with ca, fad, fmn, nap

Details for d3qe2a1

PDB Entry: 3qe2 (more details), 1.75 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qe2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qe2a1 c.23.5.0 (A:69-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
essfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlssl
peidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamg
kyvdkrleqlgaqrifelglgdddgnleedfitwreqfwlavcehfgveat

SCOPe Domain Coordinates for d3qe2a1:

Click to download the PDB-style file with coordinates for d3qe2a1.
(The format of our PDB-style files is described here.)

Timeline for d3qe2a1: