Lineage for d3qd8a_ (3qd8 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:1773] [193333] (3 PDB entries)
  8. 1486481Domain d3qd8a_: 3qd8 A: [248856]
    automated match to d1euma_

Details for d3qd8a_

PDB Entry: 3qd8 (more details), 3 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis BfrB
PDB Compounds: (A:) Probable bacterioferritin BfrB

SCOPe Domain Sequences for d3qd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qd8a_ a.25.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
qeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggrl

SCOPe Domain Coordinates for d3qd8a_:

Click to download the PDB-style file with coordinates for d3qd8a_.
(The format of our PDB-style files is described here.)

Timeline for d3qd8a_: