SCOPe 2.08: Domain d3qbgb_: 3qbg B:

Lineage for d3qbgb_ (3qbg B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (25 species)
   not a true protein

7. Species Natronomonas pharaonis [TaxId:2257] [256038] (6 PDB entries)

8. Domain d3qbgb_: 3qbg B: [248845]
   automated match to d1e12a_
   complexed with 22b, bng, ret

Details for d3qbgb_

PDB Entry: 3qbg, 1.8 Å

PDB Description: anion-free blue form of pharaonis halorhodopsin

PDB Compounds: (B:) halorhodopsin

SCOPe Domain Sequences for d3qbgb_:

Sequence; same for both SEQRES and ATOM records:

>d3qbgb_ f.13.1.0 (B:) automated matches {Natronomonas pharaonis [TaxId: 2257]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsgs

Timeline for d3qbgb_:

• d3qbgb_ first appeared in SCOPe 2.04
  
• d3qbgb_ appears in SCOPe 2.07