![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-2 (IL-2) [47301] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47302] (19 PDB entries) |
![]() | Domain d3qb1h_: 3qb1 H: [248843] automated match to d1irla_ mutant |
PDB Entry: 3qb1 (more details), 3.1 Å
SCOPe Domain Sequences for d3qb1h_:
Sequence, based on SEQRES records: (download)
>d3qb1h_ a.26.1.2 (H:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlahsknfhfdprdvvsninvfvlelkgsettfmceyadetativeflnrwitfc qsiistlt
>d3qb1h_ a.26.1.2 (H:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnkltrmltfkfympkkatelkhlqcleeelkpleev lnlahnfhfdprdvvsninvfvlelkgfmceyadetativeflnrwitfcqsiistlt
Timeline for d3qb1h_: