Lineage for d3qb1h_ (3qb1 H:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1487045Protein Interleukin-2 (IL-2) [47301] (1 species)
  7. 1487046Species Human (Homo sapiens) [TaxId:9606] [47302] (16 PDB entries)
  8. 1487067Domain d3qb1h_: 3qb1 H: [248843]
    automated match to d1irla_
    mutant

Details for d3qb1h_

PDB Entry: 3qb1 (more details), 3.1 Å

PDB Description: interleukin-2 mutant d10
PDB Compounds: (H:) interleukin-2

SCOPe Domain Sequences for d3qb1h_:

Sequence, based on SEQRES records: (download)

>d3qb1h_ a.26.1.2 (H:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlahsknfhfdprdvvsninvfvlelkgsettfmceyadetativeflnrwitfc
qsiistlt

Sequence, based on observed residues (ATOM records): (download)

>d3qb1h_ a.26.1.2 (H:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnkltrmltfkfympkkatelkhlqcleeelkpleev
lnlahnfhfdprdvvsninvfvlelkgfmceyadetativeflnrwitfcqsiistlt

SCOPe Domain Coordinates for d3qb1h_:

Click to download the PDB-style file with coordinates for d3qb1h_.
(The format of our PDB-style files is described here.)

Timeline for d3qb1h_: