SCOPe 2.08: Domain d3qb1g_: 3qb1 G:

Lineage for d3qb1g_ (3qb1 G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-2 (IL-2) [47301] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47302] (20 PDB entries)

8. Domain d3qb1g_: 3qb1 G: [248842]
   automated match to d1irla_
   mutant

Details for d3qb1g_

PDB Entry: 3qb1, 3.1 Å

PDB Description: interleukin-2 mutant d10

PDB Compounds: (G:) interleukin-2

SCOPe Domain Sequences for d3qb1g_:

Sequence, based on SEQRES records:

>d3qb1g_ a.26.1.2 (G:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlahsknfhfdprdvvsninvfvlelkgsettfmceyadetativeflnrwitfc
qsiistlt

Sequence, based on observed residues (ATOM records):

>d3qb1g_ a.26.1.2 (G:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginntfkfympkkatelkhlqcleeelkpleevlnlanf
hfdprdvvsninvfvlelkgfmceyadetativeflnrwitfcqsiistlt

Timeline for d3qb1g_:

• d3qb1g_ first appeared in SCOPe 2.04
  
• d3qb1g_ appears in SCOPe 2.07