SCOPe 2.06: Domain d3qaxb1: 3qax B:7-238

Lineage for d3qaxb1 (3qax B:7-238)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Chlamydophila pneumoniae [TaxId:83558] [189367] (3 PDB entries)

8. Domain d3qaxb1: 3qax B:7-238 [248835]
   Other proteins in same PDB: d3qaxa2, d3qaxb2
   automated match to d3n26a_
   complexed with arg

Details for d3qaxb1

PDB Entry: 3qax, 2 Å

PDB Description: crystal structure analysis of the cpb0502

PDB Compounds: (B:) Probable ABC transporter arginine-binding protein ArtJ

SCOPe Domain Sequences for d3qaxb1:

Sequence; same for both SEQRES and ATOM records:

>d3qaxb1 c.94.1.0 (B:7-238) automated matches {Chlamydophila pneumoniae [TaxId: 83558]}
drnriwivgtnatyppfeyvdaqgevvgfdidlakaiseklgkqlevrefafdalilnlk
khridailagmsitpsrqkeiallpyygdevqelmvvskrsletpvlpltqyssvavqtg
tyqehyllsqpgicvrsfdstlevimevrygkspvavlepsvgrvvlkdfpnlvatrlel
ppecwvlgcglgvakdrpeeiqtiqqaitdlksegviqsltkkwqlsevaye

Timeline for d3qaxb1:

• d3qaxb1 first appeared in SCOPe 2.04, called d3qaxb_
  
• d3qaxb1 was called d3qaxb_ in SCOPe 2.05
  
• d3qaxb1 appears in SCOPe 2.07
  
• d3qaxb1 appears in the current release, SCOPe 2.08