| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Chlamydophila pneumoniae [TaxId:83558] [189367] (3 PDB entries) |
| Domain d3qaxb1: 3qax B:7-238 [248835] Other proteins in same PDB: d3qaxa2, d3qaxb2 automated match to d3n26a_ complexed with arg |
PDB Entry: 3qax (more details), 2 Å
SCOPe Domain Sequences for d3qaxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qaxb1 c.94.1.0 (B:7-238) automated matches {Chlamydophila pneumoniae [TaxId: 83558]}
drnriwivgtnatyppfeyvdaqgevvgfdidlakaiseklgkqlevrefafdalilnlk
khridailagmsitpsrqkeiallpyygdevqelmvvskrsletpvlpltqyssvavqtg
tyqehyllsqpgicvrsfdstlevimevrygkspvavlepsvgrvvlkdfpnlvatrlel
ppecwvlgcglgvakdrpeeiqtiqqaitdlksegviqsltkkwqlsevaye
Timeline for d3qaxb1: