Lineage for d3qaxb1 (3qax B:7-238)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915392Species Chlamydophila pneumoniae [TaxId:83558] [189367] (3 PDB entries)
  8. 2915396Domain d3qaxb1: 3qax B:7-238 [248835]
    Other proteins in same PDB: d3qaxa2, d3qaxb2
    automated match to d3n26a_
    complexed with arg

Details for d3qaxb1

PDB Entry: 3qax (more details), 2 Å

PDB Description: crystal structure analysis of the cpb0502
PDB Compounds: (B:) Probable ABC transporter arginine-binding protein ArtJ

SCOPe Domain Sequences for d3qaxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qaxb1 c.94.1.0 (B:7-238) automated matches {Chlamydophila pneumoniae [TaxId: 83558]}
drnriwivgtnatyppfeyvdaqgevvgfdidlakaiseklgkqlevrefafdalilnlk
khridailagmsitpsrqkeiallpyygdevqelmvvskrsletpvlpltqyssvavqtg
tyqehyllsqpgicvrsfdstlevimevrygkspvavlepsvgrvvlkdfpnlvatrlel
ppecwvlgcglgvakdrpeeiqtiqqaitdlksegviqsltkkwqlsevaye

SCOPe Domain Coordinates for d3qaxb1:

Click to download the PDB-style file with coordinates for d3qaxb1.
(The format of our PDB-style files is described here.)

Timeline for d3qaxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qaxb2