Lineage for d3qa3j2 (3qa3 J:121-220)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518360Domain d3qa3j2: 3qa3 J:121-220 [248822]
    Other proteins in same PDB: d3qa3a1, d3qa3c1, d3qa3e_, d3qa3f1, d3qa3g_, d3qa3i_, d3qa3j1, d3qa3l_
    automated match to d1a3rl2
    complexed with ca, edo, gol

Details for d3qa3j2

PDB Entry: 3qa3 (more details), 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (J:) Antibody Light Chain

SCOPe Domain Sequences for d3qa3j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qa3j2 b.1.1.2 (J:121-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3qa3j2:

Click to download the PDB-style file with coordinates for d3qa3j2.
(The format of our PDB-style files is described here.)

Timeline for d3qa3j2: