| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
| Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
| Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [53309] (12 PDB entries) |
| Domain d3qa3i_: 3qa3 I: [248820] Other proteins in same PDB: d3qa3a1, d3qa3a2, d3qa3c1, d3qa3c2, d3qa3f1, d3qa3f2, d3qa3j1, d3qa3j2 automated match to d3q3ge_ complexed with ca, edo, gol |
PDB Entry: 3qa3 (more details), 3 Å
SCOPe Domain Sequences for d3qa3i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qa3i_ c.62.1.1 (I:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrekg
Timeline for d3qa3i_: