Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
Domain d3qa3f2: 3qa3 F:121-220 [248818] Other proteins in same PDB: d3qa3a1, d3qa3c1, d3qa3e_, d3qa3f1, d3qa3g_, d3qa3i_, d3qa3j1, d3qa3l_ automated match to d1a3rl2 complexed with ca, edo, gol |
PDB Entry: 3qa3 (more details), 3 Å
SCOPe Domain Sequences for d3qa3f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qa3f2 b.1.1.2 (F:121-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys msstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3qa3f2: