SCOPe 2.04: Domain d3qa3f2: 3qa3 F:121-220

Lineage for d3qa3f2 (3qa3 F:121-220)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3qa3f2: 3qa3 F:121-220 [248818]
   Other proteins in same PDB: d3qa3a1, d3qa3c1, d3qa3e_, d3qa3f1, d3qa3g_, d3qa3i_, d3qa3j1, d3qa3l_
   automated match to d1a3rl2
   complexed with ca, edo, gol

Details for d3qa3f2

PDB Entry: 3qa3, 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody

PDB Compounds: (F:) Antibody Light Chain

SCOPe Domain Sequences for d3qa3f2:

Sequence; same for both SEQRES and ATOM records:

>d3qa3f2 b.1.1.2 (F:121-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3qa3f2:

• d3qa3f2 is new in SCOPe 2.04-stable
  
• d3qa3f2 appears in SCOPe 2.05
  
• d3qa3f2 appears in the current release, SCOPe 2.08