Lineage for d3q8aa2 (3q8a A:226-734)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2581113Fold f.60: Anthrax protective antigen C-terminal-like [254103] (1 superfamily)
    C-terminal 3 domains; II (226-487) is beta-sandwiches of gamma-crystallin like topology, similar to domain I; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold
  4. 2581114Superfamily f.60.1: Anthrax protective antigen C-terminal-like [254122] (1 family) (S)
  5. 2581115Family f.60.1.1: Anthrax protective antigen C-terminal-like [254146] (2 proteins)
  6. 2581145Protein automated matches [254717] (1 species)
    not a true protein
  7. 2581146Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256037] (1 PDB entry)
  8. 2581147Domain d3q8aa2: 3q8a A:226-734 [248804]
    Other proteins in same PDB: d3q8aa1
    automated match to d1acca1
    complexed with ca

Details for d3q8aa2

PDB Entry: 3q8a (more details), 3.13 Å

PDB Description: Crystal structure of WT Protective Antigen (pH 5.5)
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3q8aa2:

Sequence, based on SEQRES records: (download)

>d3q8aa2 f.60.1.1 (A:226-734) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsq
trtiskntstsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagert
waetmglntadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqil
apnnyypsknlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfe
ngrvrvdtgsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlke
alkiafgfnepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklna
kmnilirdkrfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyive
iedteglkevindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtken
tiinpsengdtstngikkilifskkgyei

Sequence, based on observed residues (ATOM records): (download)

>d3q8aa2 f.60.1.1 (A:226-734) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedsqtrtiskn
tstsrthtsagfsnsnsstvaidhslsagertwaetmglntadtarlnaniryvntgtap
iynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqddfsstpit
mnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqettariif
ngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgkditefdfn
fdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgadesvvk
eahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrqdgk
tfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskkgye
i

SCOPe Domain Coordinates for d3q8aa2:

Click to download the PDB-style file with coordinates for d3q8aa2.
(The format of our PDB-style files is described here.)

Timeline for d3q8aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q8aa1