Lineage for d3q8aa1 (3q8a A:15-225)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434421Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2434422Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2434490Family b.179.1.0: automated matches [254312] (1 protein)
    not a true family
  6. 2434491Protein automated matches [254716] (2 species)
    not a true protein
  7. 2434492Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256036] (1 PDB entry)
  8. 2434493Domain d3q8aa1: 3q8a A:15-225 [248803]
    Other proteins in same PDB: d3q8aa2
    automated match to d1acca2
    complexed with ca

Details for d3q8aa1

PDB Entry: 3q8a (more details), 3.13 Å

PDB Description: Crystal structure of WT Protective Antigen (pH 5.5)
PDB Compounds: (A:) Protective antigen

SCOPe Domain Sequences for d3q8aa1:

Sequence, based on SEQRES records: (download)

>d3q8aa1 b.179.1.0 (A:15-225) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks
deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl
ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv
dvknkrtflspwisnihekkgltkyksspek

Sequence, based on observed residues (ATOM records): (download)

>d3q8aa1 b.179.1.0 (A:15-225) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ssqgllgyyfsdlnfqapmvvtssttgdlsipsselsenqyfqsaiwsgfikvsdeytfa
tsadnhvtmwvddqevinnkirlekgrlyqikiqyqrenptekgldfklywtdsqnkkev
issdnlqlpelkqkssnsrkkrpdrdndgipdslevegytvdvknkrtflspwisnihek
kgltkyksspek

SCOPe Domain Coordinates for d3q8aa1:

Click to download the PDB-style file with coordinates for d3q8aa1.
(The format of our PDB-style files is described here.)

Timeline for d3q8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q8aa2