Class b: All beta proteins [48724] (177 folds) |
Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily) core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains |
Superfamily b.179.1: PA14-like [254123] (3 families) |
Family b.179.1.0: automated matches [254312] (1 protein) not a true family |
Protein automated matches [254716] (1 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256036] (1 PDB entry) |
Domain d3q8aa1: 3q8a A:15-225 [248803] Other proteins in same PDB: d3q8aa2 automated match to d1acca2 complexed with ca |
PDB Entry: 3q8a (more details), 3.13 Å
SCOPe Domain Sequences for d3q8aa1:
Sequence, based on SEQRES records: (download)
>d3q8aa1 b.179.1.0 (A:15-225) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkks deytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkl ywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytv dvknkrtflspwisnihekkgltkyksspek
>d3q8aa1 b.179.1.0 (A:15-225) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ssqgllgyyfsdlnfqapmvvtssttgdlsipsselsenqyfqsaiwsgfikvsdeytfa tsadnhvtmwvddqevinnkirlekgrlyqikiqyqrenptekgldfklywtdsqnkkev issdnlqlpelkqkssnsrkkrpdrdndgipdslevegytvdvknkrtflspwisnihek kgltkyksspek
Timeline for d3q8aa1: