![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:273075] [256035] (1 PDB entry) |
![]() | Domain d3q7jb4: 3q7j B:490-780 [248802] Other proteins in same PDB: d3q7ja1, d3q7ja2, d3q7ja3, d3q7jb1, d3q7jb2, d3q7jb3 automated match to d1z1wa4 complexed with fbo, zn |
PDB Entry: 3q7j (more details), 2.91 Å
SCOPe Domain Sequences for d3q7jb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7jb4 a.118.1.0 (B:490-780) automated matches {Thermoplasma acidophilum [TaxId: 273075]} datfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffddedhnvitaiv gqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvdesyaeemsk lfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafgklksntdls tvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgnrtasrtvem mipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk
Timeline for d3q7jb4:
![]() Domains from other chains: (mouse over for more information) d3q7ja1, d3q7ja2, d3q7ja3, d3q7ja4 |