Lineage for d3q7jb4 (3q7j B:490-780)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726242Species Thermoplasma acidophilum [TaxId:273075] [256035] (1 PDB entry)
  8. 2726244Domain d3q7jb4: 3q7j B:490-780 [248802]
    Other proteins in same PDB: d3q7ja1, d3q7ja2, d3q7ja3, d3q7jb1, d3q7jb2, d3q7jb3
    automated match to d1z1wa4
    complexed with fbo, zn

Details for d3q7jb4

PDB Entry: 3q7j (more details), 2.91 Å

PDB Description: Engineered Thermoplasma Acidophilum F3 factor mimics human aminopeptidase N (APN) as a target for anticancer drug development
PDB Compounds: (B:) Tricorn protease-interacting factor F3

SCOPe Domain Sequences for d3q7jb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7jb4 a.118.1.0 (B:490-780) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
datfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffddedhnvitaiv
gqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvdesyaeemsk
lfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafgklksntdls
tvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgnrtasrtvem
mipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk

SCOPe Domain Coordinates for d3q7jb4:

Click to download the PDB-style file with coordinates for d3q7jb4.
(The format of our PDB-style files is described here.)

Timeline for d3q7jb4: