Lineage for d3q7jb2 (3q7j B:171-414)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206323Species Thermoplasma acidophilum [TaxId:273075] [256033] (1 PDB entry)
  8. 2206325Domain d3q7jb2: 3q7j B:171-414 [248800]
    Other proteins in same PDB: d3q7ja1, d3q7ja3, d3q7ja4, d3q7jb1, d3q7jb3, d3q7jb4
    automated match to d1z1wa2
    complexed with fbo, zn

Details for d3q7jb2

PDB Entry: 3q7j (more details), 2.91 Å

PDB Description: Engineered Thermoplasma Acidophilum F3 factor mimics human aminopeptidase N (APN) as a target for anticancer drug development
PDB Compounds: (B:) Tricorn protease-interacting factor F3

SCOPe Domain Sequences for d3q7jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7jb2 d.92.1.0 (B:171-414) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
ryeyekyrdidlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgag
amenwgaitfreiymdiaensavtvkrnsatviaheiahqwfgdlvtmkwwndlwlnesf
atfmsyktmdtlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeis
ygkgasilrmiedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeyw
iknp

SCOPe Domain Coordinates for d3q7jb2:

Click to download the PDB-style file with coordinates for d3q7jb2.
(The format of our PDB-style files is described here.)

Timeline for d3q7jb2: